PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G322100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 327aa    MW: 36045.8 Da    PI: 6.1899
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G322100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092432762255
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +yps++e+  LA+++gL+++q+ +WF N+R ++
  Brast02G322100.1.p 243 WPYPSETEKIALAESTGLDQKQINNWFINQRKRH 276
                         59*****************************885 PP

2ELK43.46.7e-15196217122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELKhqLlrKY+gy gsL+qEF+
  Brast02G322100.1.p 196 ELKHQLLRKYGGYVGSLRQEFC 217
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.4E-1864108IPR005540KNOX1
PfamPF037901.7E-1965106IPR005540KNOX1
SMARTSM012561.4E-28116167IPR005541KNOX2
PfamPF037912.1E-24120166IPR005541KNOX2
PfamPF037898.7E-11196217IPR005539ELK domain
PROSITE profilePS5121311.453196216IPR005539ELK domain
SMARTSM011889.7E-8196217IPR005539ELK domain
PROSITE profilePS5007112.989216279IPR001356Homeobox domain
SMARTSM003893.4E-13218283IPR001356Homeobox domain
SuperFamilySSF466896.84E-20218290IPR009057Homeodomain-like
CDDcd000864.54E-15219279No hitNo description
Gene3DG3DSA:1.10.10.602.3E-28221283IPR009057Homeodomain-like
PfamPF059206.4E-17236275IPR008422Homeobox KN domain
PROSITE patternPS000270254277IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MERFRELGGG GSSSAGSMAS FLQLPLPAAA SSPELIPPAG AEHHGSRLAL HQLLSIPPPA  60
PDAEAVKAKI MAHPLYSPLL ASYLDCHKVG AAPDVLDRLS AVAAKQQLDA AERRGHREPP  120
RADPELDQFM EAYCNMLAKY REELARPIRE ATEFFRSVET QLDSITDSNC EGAGSSEDDL  180
DTSCPEEIDP SAEDKELKHQ LLRKYGGYVG SLRQEFCKRR KKGKLPKEAR QKLLQWWELH  240
CKWPYPSETE KIALAESTGL DQKQINNWFI NQRKRHWKPA SEDMPFSMMG GGGGGFDHDP  300
PGGGAAALYM LDRSPFMVDG MYRLGS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00671PBMTransfer from GRMZM2G135447Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4434550.0AB443455.1 Triticum aestivum WRS1 mRNA for homeobox protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229205.10.0PREDICTED: homeobox protein knotted-1-like 12 isoform X4
SwissprotQ10ED21e-113KNOS8_ORYSJ; Homeobox protein knotted-1-like 8
TrEMBLA0A0Q3J4U20.0A0A0Q3J4U2_BRADI; Uncharacterized protein
STRINGBRADI1G07247.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.17e-88KNOTTED-like from Arabidopsis thaliana